PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B03941.1.p
Common NameEUGRSUZ_B03941, LOC104434062
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 313aa    MW: 35114.4 Da    PI: 5.9228
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B03941.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.22.6e-151462148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      rg+W++eEd +l d++++ G+g +W + +++  ++R++k+c++rw++yl
  Eucgr.B03941.1.p 14 RGPWSPEEDAKLRDYIEKNGTGgNWIALPQKADLKRCGKSCRLRWLNYL 62
                      89*********************************************97 PP

2Myb_DNA-binding33.87.7e-1169111246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g ++ eEd  +  + +  G++ W+ Ia+ ++ gRt++++k++w++
  Eucgr.B03941.1.p  69 GEFSIEEDRVICTLYATIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                       78999****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.834962IPR017930Myb domain
SuperFamilySSF466899.61E-2711109IPR009057Homeodomain-like
SMARTSM007171.2E-101364IPR001005SANT/Myb domain
PfamPF002493.5E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-231569IPR009057Homeodomain-like
CDDcd001671.06E-81662No hitNo description
PROSITE profilePS5129421.13363117IPR017930Myb domain
SMARTSM007179.0E-1067115IPR001005SANT/Myb domain
PfamPF002491.3E-969111IPR001005SANT/Myb domain
CDDcd001677.01E-770113No hitNo description
Gene3DG3DSA:1.10.10.607.1E-2370117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGRAPCCDKA NVKRGPWSPE EDAKLRDYIE KNGTGGNWIA LPQKADLKRC GKSCRLRWLN  60
YLRPNIKHGE FSIEEDRVIC TLYATIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLMSV  120
IPQFNQRKAP PPFPDSYQNS PLSLSSQMLP PLSLDSSSQY YACGLNKQFA SHEFASLPQY  180
LSTNDNNSLG NPNNCSSFQA PEGYYSPLKE SNNFMFGGEG SCSCSDGSSG GQIGQTREII  240
KQEEMGFQDY SIYSDYAYQC VEKTNGYFGE NIAESYDLED VKKLMGSTSL SCNGSILDEN  300
KEELKLMPMY YF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-24141177108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B03941.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010045316.10.0PREDICTED: transcription factor RAX2-like
TrEMBLA0A059DA950.0A0A059DA95_EUCGR; Uncharacterized protein
STRINGPOPTR_0009s01270.11e-103(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.16e-76myb domain protein 36